Deleted tweet detection is currently running at reduced capacity due to changes to the Twitter API. Some tweets that have been deleted by the tweet author may not be labeled as deleted in the PolitiTweet interface.

Showing page 42 of 1083.

Profile Image

Nicholas Soames @NSoames

RT @mimsdavies: Joined final of @NSoames šŸŒŸTrophy with @samm72smithh at #LindfieldBowlsClub on Sat-šŸ‘it was Barcombe won out over #HaywardsHeā€¦ — PolitiTweet.org

Posted Sept. 13, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

Wonderfully touching Tribute to the Victims of 9/11 that the Band at the Changing of the Guard at Windsor Castle today played The Stars and Stripes #whateverourtemporarydisagreementsGODBLESSAMERICA — PolitiTweet.org

Posted Sept. 11, 2021
Profile Image

Nicholas Soames @NSoames

RT @guywalters: It's worth noting that the Churchill Fellowship name change evoked no furore when it happened three weeks ago. The furore oā€¦ — PolitiTweet.org

Posted Sept. 10, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @Adrian_Hilton: I'm with Sir @NSoames on this: the Churchill Fellowship has quite obviously not 'cancelled' the name of Winston Churchilā€¦ — PolitiTweet.org

Posted Sept. 9, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @rgpoulussen: #OTD in 1940, East End of London. Churchill taking it all in. #WW2 #HISTORY https://t.co/qQlbz3CmbR — PolitiTweet.org

Posted Sept. 9, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @MichaelAodhan: No big speeches and no big interviews. Just lots of exchange of information and talking through the problems and pitchinā€¦ — PolitiTweet.org

Posted Sept. 9, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @FellowMarkW: @UOSMICE @NSoames Thank you for seeing through the faux outrage. No one pretends he was a perfect man & no one is trying tā€¦ — PolitiTweet.org

Posted Sept. 9, 2021 Retweet Deleted after a month
Profile Image

Nicholas Soames @NSoames

RT @FellowMarkW: Sir Nicholas Soames, one of Churchillā€™s grandchildren, said in a statement: ā€œI & the rest of my family, fully and unreservā€¦ — PolitiTweet.org

Posted Sept. 9, 2021 Retweet Deleted after a month
Profile Image

Nicholas Soames @NSoames

RT @GavinBarwell: First copies of my book arrived yesterday. It's published in a week's time. If you're interested in what goes on behind tā€¦ — PolitiTweet.org

Posted Sept. 9, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @LNevilleRolfe: Opening up. Superb to welcome Chancellor @RishiSunak to @UKHouseofLords Association of Conservative Peers reception. Witā€¦ — PolitiTweet.org

Posted Sept. 9, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @TheEconomist: It is all too easy to see a sequence of events unfolding that could lead to another unnecessary war, warns historian Nialā€¦ — PolitiTweet.org

Posted Sept. 9, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @benhowlettuk: End of an era, Ken Clarke giving his final speech as President of the Conservative European Forum @ConsEurope as he handsā€¦ — PolitiTweet.org

Posted Sept. 7, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @Jeremy_Hunt: Thank you @BorisJohnson, @RishiSunak, @sajidjavid for taking a tough and politically difficult decision to give the NHS anā€¦ — PolitiTweet.org

Posted Sept. 7, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @curlewcalls: I can't wait to go away for 3 weeks from Friday to walk half of the St Francis Way, the section between Florence and Assisā€¦ — PolitiTweet.org

Posted Sept. 5, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @NSoames: Was delighted to meet when in Dubai, HE Reem Al Hashimy Minister for International Cooperation. A truly exceptional person cuā€¦ — PolitiTweet.org

Posted Sept. 5, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @curlewcalls: Seen on Facebook - šŸ˜‚šŸ‘‡ https://t.co/ehrpsGVLQS — PolitiTweet.org

Posted Sept. 3, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @northumbriana: Unpopular opinion, but I think Lincoln Cathedral might actually be more impressive than Durham ā€¦ https://t.co/oSLFu228LH — PolitiTweet.org

Posted Sept. 3, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @willquince: An honour to join the Prime Minister @BorisJohnson at Merville Barracks in Colchester today where we met and thanked @16Airā€¦ — PolitiTweet.org

Posted Sept. 3, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @SouthEngShows: ONLY 1 MONTH TO GO šŸ˜± Find yourself here at the #AutumnShowAndGameFair on October 2nd & 3rd šŸ‚ The weekend event is jam-pā€¦ — PolitiTweet.org

Posted Sept. 3, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

@herdyshepherd1 #magnificent — PolitiTweet.org

Posted Sept. 2, 2021
Profile Image

Nicholas Soames @NSoames

RT @herdyshepherd1: https://t.co/AlBr9EOL7Y — PolitiTweet.org

Posted Sept. 2, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

@TheSun #criminaldamagetakethwmawayplease — PolitiTweet.org

Posted Sept. 1, 2021
Profile Image

Nicholas Soames @NSoames

RT @northumbriana: The coat Nelson wore at Trafalgar. Note bullet hole under the left epaulette. https://t.co/8oAFfek0wc — PolitiTweet.org

Posted Sept. 1, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

RT @justinmarozzi: The spectacular Kidalton Cross on Islay, one of the finest Celtic crosses in Scotland. Mind-boggling to think it dates bā€¦ — PolitiTweet.org

Posted Sept. 1, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

@herdyshepherd1 #buyitBrilliant — PolitiTweet.org

Posted Sept. 1, 2021
Profile Image

Nicholas Soames @NSoames

@JBrokenshire @GSTTnhs #bestwishesandthoughtsKBO — PolitiTweet.org

Posted Aug. 31, 2021
Profile Image

Nicholas Soames @NSoames

@haynesdeborah @SkyNews @thetimes #congratulations — PolitiTweet.org

Posted Aug. 31, 2021
Profile Image

Nicholas Soames @NSoames

@hacklebw #ProudtodosooneofthrgreatestRegimentsoftheBritishArmy — PolitiTweet.org

Posted Aug. 30, 2021
Profile Image

Nicholas Soames @NSoames

RT @hacklebw: @NSoames @NSoames stuck up for the black watch when nobody would when tony blair sent the battalion into fallujah to supportā€¦ — PolitiTweet.org

Posted Aug. 30, 2021 Retweet
Profile Image

Nicholas Soames @NSoames

@IainDale @LBC #thankGod — PolitiTweet.org

Posted Aug. 30, 2021